The therapeutic potential of glucose-dependent insulinotropic polypeptide (GIP) for improving glycemic control has largely gone unstudied. A series of synthetic GIP peptides modified at the NH2-terminus were screened in vitro for resistance to dipeptidyl peptidase IV (DP IV) degradation and potency to stimulate cyclic AMP and affinity for the transfected rat GIP receptor. In vitro experiments indicated that [d-Ala2]GIP possessed the greatest resistance to enzymatic degradation, combined with minimal effects on efficacy at the receptor. Thus, [d-Ala2]GIP1–42 was selected for further testing in the perfused rat pancreas and bioassay in conscious Wistar and Zucker rats. When injected subcutaneously in normal Wistar, Fa/?, or fa/fa Vancouver Diabetic Fatty (VDF) Zucker rats, both GIP and [d-Ala2]GIP significantly reduced glycemic excursions during a concurrent oral glucose tolerance test via stimulation of insulin release. The latter peptide displayed greater in vivo effectiveness, likely because of resistance to enzymatic degradation. Hence, despite reduced bioactivity in diabetic models at physiological concentrations, GIP and analogs with improved plasma stability still improve glucose tolerance when given in supraphysiological doses, and thus may prove useful in the treatment of diabetic states.

GIP (glucose-dependent insulinotropic polypeptide; also called gastric inhibitory polypeptide; 1YAEGTFISDYSIAMDKIHQQDFVNWLLAQKG-KKNDWKHNITQ42) is an incretin hormone released from the upper small bowel in response to luminal nutrients that amplifies insulin release from pancreatic β-cells (1). GIP modulates ion currents (24) and stimulates proximal and distal steps of the exocytotic cascade (2) by acting on a seven-transmembrane-spanning G-protein-coupled receptor coupled to stimulation of adenylyl cyclase, activation of phospholipase A2, and increases in intracellular calcium (5,6). In addition to enhancing insulin release, GIP further acts as an insulinotropic agent by stimulating proinsulin gene transcription and translation (7,8) and upregulating plasmalemmal glucose transporters and hexokinase in the β-cell (8). There is currently interest in the potential use of incretins in the treatment of type 2 diabetes, although to date, clinical trials have been limited to glucagon-like peptide-1 (GLP-1) (9).

One of the major drawbacks with the use of either GIP or GLP-1 as potential therapeutic agents is their short duration of action, due to enzymatic degradation in vivo. The enzyme dipeptidyl peptidase IV (DP IV), a serine protease that preferentially hydrolyses peptides after a penultimate NH2-terminal proline (Xaa-Pro-) or alanine (Xaa-Ala-) (10,11), has been shown to rapidly metabolize GIP and GLP-1 in vitro (1214). After intravenous injections into rats, the half time of NH2-terminal truncation of [125I]-labeled GIP or GLP-1 was <2 min (12). Sensitive mass spectrometric techniques verified that GIP3–42 and GLP-1[9-36NH2] were the major degradation products of the incretins when incubated in human serum (15). Enhancement of the enteroinsular axis in DP IV-null mice (16) or inhibition of DP IV activity in vivo (1720) results in improved glucose tolerance. In patients with type 2 diabetes, GLP-1[7–36] was found to be rapidly degraded to GLP-1[9–36] (21), indicating that a defect in DP IV action, resulting in prolonged exposure to intact GIP and GLP-1, does not contribute to the reduced incretin responses in these individuals.

In the current study, the potential of a DP IV-resistant analog of GIP as a therapeutically useful insulinotropic agent has been assessed with both in vitro and in vivo assays. In vitro studies were initially performed with Chinese hamster ovary (CHO-K1) cells transfected with the GIP receptor (wtGIPR cells) to determine the importance of the DP IV-sensitive NH2-terminal dipeptide, Tyr1-Ala2, for receptor binding and stimulation of cyclic AMP production. It was established that substitution of a d-alanine in position 2 resulted in a peptide, [d-Ala2]GIP, with similar receptor binding and activation characteristics to those of native GIP. Because we had previously shown that this analog was among the most DP IV-resistant when incubated with purified enzyme, as examined by mass spectrometry (22), it was selected for further study. Chromatographic studies confirmed DP IV resistance in vitro, and studies in the isolated perfused rat pancreas and using a bioassay in normal Wistar and lean and obese Vancouver Diabetic Fatty (VDF) Zucker rats established that this analog is able to improve glucose tolerance in these animals. It is therefore a promising therapeutic agent for the treatment of type 2 diabetes.

Peptides.

Synthetic human GIP1–42, [Ala1-Tyr2]GIP1–42, [d-Ala2]GIP1–42, and GIP3–42 were purchased from Hukabel (Montreal, Canada) and synthetic porcine GIP1–42 from Bachem (Torrance, CA). Batches of GIP1–42 (Mass+H+: measured, 4,984.7 g/mol; expected, 4,983.6 g/mol) and [d-Ala2]GIP1–42 (Mass+Na+: measured, 4,998.6 g/mol; expected, 5,002.7 g/mol) were also synthesized (Probiodrug, Halle, Germany), using methods described in detail elsewhere (22).

Animals.

Male Wistar rats were purchased from the University of British Columbia Animal Care Facility (Vancouver, Canada); male VDF Zucker rats (23) were obtained from the colony maintained in the Department of Physiology, University of British Columbia. Animals were held in group housing with free access to rat food and water, with a 12-h light:dark cycle. Animals were fasted overnight (15–18 h) before experimentation. Anesthesia, where indicated, was achieved with intraperitoneal Somnotol (65 mg/kg sodium pentobarbital; MTC Pharmaceuticals, Cambridge, Canada). Animal experiments conformed to the guidelines set forth by the University of British Columbia Committee on Animal Care and the Canadian Council on Animal Care.

Peptide iodination and purification.

Monocomponent [125I-Tyr10]GIP1–42 (∼300 μCi/mg) was prepared according to established protocols (12), and iodination of [d-Ala2]GIP1–42 was based on these techniques. Briefly, 1 mCi of carrier-free iodine-125 (PerkinElmer Life Sciences, Boston, MA) was added to 1 nmol peptide dissolved in 100 μl of 0.4 mol/l phosphate buffer (pH 7.5), iodination was initiated by addition of 10 μl chloramine-T (14.2 mmol/l in 0.4 mol/l PO4 buffer [BDH, Toronto, Canada]) for 15 s, and the reaction was quenched with 20 μl sodium metabisulfite (66.3 mmol/l in 0.4 mol/l PO4 buffer [Fisher Scientific, Fair Lawn, NJ]). Radiolabeled peptide was separated from free iodine by gel filtration (Sephadex G-15 [Pharmacia, Uppsala, Sweden]) in 0.2 mol/l acetic acid with 0.5% BSA (RIA fraction V; Sigma Chemical, St. Louis, MO) and 2% Trasylol (aprotinin; Bayer, Etobicoke, Canada). Labeled peptides were then purified by high-performance liquid chromatography (HPLC) to yield an apparent single molecular species, as described below. Iodinated products of [d-Ala2]GIP1–42 have not been previously characterized; five major peaks were identified on the chromatogram, and peaks 2 and 4 showed the greatest specific binding at the GIP receptor (data not shown; protocol described below). Peak 2 eluted with a similar retention time as that of [125I-Tyr10]GIP1–42 and appeared to be the predominant iodinated product, and thus was used in subsequent experiments.

DP IV degradation studies.

Purified pork kidney DP IV was prepared as previously described (24) to a specific activity of 31.2 units/mg. The hydrolysis of iodinated peptides by purified DP IV was studied as previously described (12). In brief, radiolabeled peptides (750,000 cpm/150 μl) were incubated in HEPES-buffered saline (HBS) (40 mmol/l HEPES, 154 mmol/l NaCl, pH 7.6) with or without DP IV (10 mU) for 16 h. Samples were resolved by HPLC using a CH3CN (Fisher Scientific)/trifluoroacetic acid (TFA) (0.1% vol/vol; Pierce Chemical, Rockford, IL) and H2O/0.1% TFA solvent system at a flow rate of 1 ml/min, according to published methods (12). Iodinated peptides (∼50,000 cpm/20 μl injection) were separated by a protocol consisting of 14 min at 32% CH3CN/0.1% TFA and a linear gradient to 38% CH3CN/0.1% TFA over 10 min, followed by a further 5 min at 38% CH3CN/0.1% TFA. Fractions were collected at 15-s intervals between minutes 5 and 27 of this protocol. Data were normalized to the total radioactivity recovered in all of these fractions. Between each sample injection, the C-18 μ-Bondapak HPLC column (Waters, Milford, MA) was rinsed for 20 min in 100% CH3CN/0.1% TFA, and any residual radioactivity was removed with three consecutive injections of 300 μl DMSO (Sigma); the sample port was rinsed with 400 μl H2O, and the column was allowed to re-equilibrate at 32% CH3CN/0.1% TFA for 5 min before the next injection. Under these conditions, a second peak eluting earlier than intact [125I]GIP1–42 has been confirmed to be [125I]GIP3–42 by Edman degradation analysis (12).

Receptor activation and binding affinity studies.

Receptor studies were performed in a heterologous expression system: CHO-K1 cells transfected with the rat pancreatic islet GIP receptor (wtGIPR cells) (25,26). Cells were cultured in 1:1 Dulbecco’s modified Eagle’s medium and Ham’s F12 nutrient mixture (DMEM/F12) (Gibco BRL, Burlington, Canada) with 10% newborn bovine calf serum (Cansera, Rexdale, Canada), antibiotics (Gibco), and 0.8 mg/ml Geneticin (G418; Gibco). At 80–90% confluence, cells were harvested with trypsin/EDTA (Gibco) and seeded at 5 × 104 cells per well into 24-well plates (Falcon; Becton Dickinson, Mississauga, Canada). Experiments were carried out 48 h later.

Wild-type GIPR cells (3–5 × 105 cells per well) were washed twice with 37°C 15 mmol/l HEPES (Sigma)-buffered (pH 7.4) DMEM/F12 containing 0.1% BSA and allowed to preincubate for 1 h at 37°C. A 30-min stimulation of cells followed in the same buffer, additionally supplemented with 0.5 mmol/l isobutylmethyl xanthine (Research Biochemicals International, Natick, MA), at the peptide concentrations indicated in the figures (0–1 μmol/l, except where noted). Cells were then lysed in ice-cold ethanol (70%), cellular debris was removed by centrifugation, and cell contents were dried in vacuo (Speed Vac; Savant, Farmingdale, NY). cAMP levels were determined using a radioimmunoassay kit (Biomedical Technologies, Stoughton, MA) and expressed in terms of fmol/1,000 cells or % maximal GIP1–42-stimulated cAMP production. Antagonism experiments were carried out according to previously published protocols (25,27,28). In these studies, cells were additionally preincubated for 15 min with varying concentrations of antagonist, followed by addition of 1 nmol/l GIP1–42; after 30 min, cells were treated according to the above protocol.

Receptor binding studies using [125I]GIP were completed essentially as described previously (26,28). A separate series of experiments was also carried out using [125I]-[d-Ala2]GIP1–42 as the radioligand, according to the same methodology. wtGIPR cells were washed twice in ice-cold HEPES-buffered DMEM/F12 with BSA (defined above) and incubated at 4°C for 12–16 h with 50,000 cpm [125I]GIP or [125I]-[d-Ala2]GIP in the presence of GIP or analogs (0–1 μmol/l, except where noted) in the same buffer, additionally supplemented with 1% Trasylol. After incubation, cells were washed twice with ice-cold buffer, solubilized with 0.1 mol/l NaOH (1 ml), and transferred to test tubes for counting of cell-associated radioactivity. Nonspecific binding was defined as radioactivity measured in the presence of 1 μmol/l GIP1–42.

Perfused rat pancreas.

The insulinotropic activity of [d-Ala2]GIP1–42 relative to native GIP was assessed in the perfused rat pancreas as previously described (28,29). In brief, overnight-fasted Wistar rats were anesthetized, and the pancreas plus associated duodenum were isolated. Perfusate consisted of a modified Krebs-Ringer buffer containing 3% dextran (Sigma) and 0.2% BSA, gassed with 95% O2/5% CO2 to achieve a pH of 7.4. The peptides were delivered as a linear gradient (0–1 nmol/l) over a 45-min period in the presence of 16.7 mmol/l glucose. Effluent samples were collected, and insulin content was measured by radioimmunoassay (RIA) (described below).

Bioassay in conscious rats.

To examine the effectiveness of GIP or analogs in vivo, a bioassay was developed for the conscious unrestrained rat. Male Wistar rats (∼290 g) were fasted overnight and then given an oral glucose tolerance test (OGTT) (1 g glucose/kg body wt) with concurrent subcutaneous saline or peptide (8 nmol/kg) injection (500 μl). Blood samples were taken at indicated times from the tail vein using heparinized capillary tubes, and the plasma was separated by centrifugation (6,000 rpm, 12 min, 4°C) for RIA. Blood glucose was measured every 10 min using a SureStep glucose analyzer (LifeScan Canada, Burnaby, Canada). Similar experiments were subsequently carried out using age-matched 16- to 20-week-old lean (Fa/?) and obese (fa/fa) VDF Zucker rats (∼335 g and 575 g, respectively).

RIA for insulin and GIP.

Insulin measurement by RIA was done using GP01 insulin antisera (1:1,000,000 final dilution) under disequilibrium conditions with rat insulin (Linco Research, St. Charles, MO) as a standard. After 24 h at 4°C, 2000 cpm of chloramine-T iodinated porcine insulin (Sigma) was added to all tubes; subsequent to another 24 h 4°C incubation, antibody-bound and free radioactive insulin were separated by centrifugation with dextran-coated charcoal. This protocol has been previously reported (28).

Measurement of GIP by RIA was performed as previously described using a COOH-terminally directed antibody (30). Plasma samples were appropriately diluted in GIP RIA buffer (5% charcoal-extracted human donor plasma, 2% Trasylol, 40 mmol/l phosphate buffer, pH 6.5) and incubated with GIP antiserum RK343F (1:300,000 final dilution) at 4°C. [125I]GIP (5,000 cpm) was added 24 h later and, after a second 24-h incubation, antibody-bound and free radiolabeled GIP were separated by PEG-8000 precipitation (12.5% wt/vol final concentration; BDH) and centrifugation.

Analytical methods.

Data are presented as means ± SE. Receptor binding and cAMP data were analyzed using the nonlinear regression analysis program Prism (version 3.02; Graphpad, San Diego, CA). Student’s t test or ANOVA followed by the Newman-Keuls multiple comparison test was performed where appropriate. P < 0.05 was considered significant; F tests confirmed that variances were equal. Integrated glucose and insulin responses were calculated using the trapezoidal method, using the algorithm included in the Prism software package and basal levels as a baseline.

Importance of GIP’s amino terminus.

Initial studies were targeted at determining the importance of the NH2-terminal amino acids, Tyr1 and Ala2, for GIP receptor binding and activation of adenylyl cyclase. In competitive binding studies with wtGIPR cells, removal of the NH2-terminal dipeptide Tyr1-Ala2 from GIP resulted in a peptide (GIP3–42) that displaced binding of [125I]GIP, but with a significant shift to the right in the displacement curve: half-maximal inhibitory concentration (IC50) for GIP3–42 was 58.4 ± 18.8 nmol/l; for GIP1–42, the IC50 was 3.56 ± 0.81 nmol/l (Fig. 1A). Despite high affinity for the GIP receptor, synthetic GIP3–42 was found to have no effect on cAMP production in wtGIPR cells at concentrations as high as 10 μmol/l (Fig. 1B). Reversing the order of the first two amino acids of GIP ([Ala1-Tyr2]GIP1–42) resulted in a molecule with a similar binding affinity to GIP3–42 (IC50 67.0 ± 20.3 nmol/l) that also failed to stimulate cAMP production, emphasizing the importance of the integrity of the first two amino acid residues for high-affinity binding (Fig. 1). Both GIP3–42 and [Ala1-Tyr2]GIP1–42 significantly inhibited cAMP production in response to 1 nmol/l GIP1–42, in a concentration-dependent manner. cAMP production was inhibited by 45.6 ± 5.2% (GIP3–42) and 40.5 ± 4.6% ([Ala1-Tyr2]GIP1–42) and by 91.0 ± 0.9% (GIP3–42), and 90.9 ± 0.4% ([Ala1-Tyr2]GIP1–42) at peptide concentrations of 1 and 10 μmol/l, respectively (Fig. 2A). This antagonism appears to be a reversible competitive blockade of receptor activation, since 10 μmol/l GIP3–42 right-shifted the half-maximal cAMP production of GIP1–42 by ninefold when added to a concentration-response curve, but did not significantly diminish the maximal response (Fig. 2B).

For a peptide to be a suitable substrate for DP IV proteolysis, amino acid residues in the first two positions must be l-isomers and the linkage between them in the trans conformation. Therefore the l-amino acid in position 2 of GIP was substituted with the d-isomer. Resistance of peptides to hydrolysis by purified pork kidney DP IV was previously monitored by MALDI-TOF (matrix-assisted laser/desorption ionisation, time of flight analyzer) mass spectrometry; GIP1–42 was shown to be degraded rapidly (t1/2 = 2.68 ± 0.16 min) by DP IV, whereas P2 substitution with d-Ala resulted in a peptide completely resistant to DP IV degradation (22). When incubated with purified porcine DP IV, [125I]GIP1–42 (retention time [RT] = 14.3 ± 0.3 min) was completely degraded to [125I]GIP3–42 (RT = 10.3 ± 0.1 min), as resolved by HPLC (Fig. 3A). Similar studies using [125I]-[d-Ala2]GIP1–42 (RT = 16.4 ± 0.2 min) indicated that it was not a substrate of DP IV (Fig. 3B), since no peak corresponding to [125I]GIP3–42 eluted.

Receptor binding and biological activity of GIP1–42 and [d-Ala2]GIP1–42 in vitro were not significantly different. In binding competition assays, regardless of whether the radioligand used was [125I]GIP1–42 or [125I]-[d-Ala2]GIP1–42, IC50 values were equivalent (Fig. 4). [d-Ala2]GIP1–42 showed nearly equal cAMP-stimulating potency to that of native GIP on wtGIPR cells (half-maximal stimulatory concentration [EC50] values: GIP1–42, 183 ± 18 pmol/l; [d-Ala2]GIP1–42, 630 ± 119 pmol/l; P < 0.05) (Fig. 5A). In view of the strong resistance to DP IV degradation and the minimal change in receptor affinity and cAMP potency with [d-Ala2]GIP1–42 (Figs. 35), its effect on insulin secretion in the isolated perfused rat pancreas was examined (Fig. 5B). In agreement with the cAMP data, integrated insulin responses to [d-Ala2]GIP1–42 (0.927 ± 0.029 μmol, n = 5) were only slightly smaller than those with GIP1–42 (1.130 ± 0.037 μmol, n = 5; P < 0.05) (Fig. 5B); when we perfused the pancreases of these animals with 16.7 mmol/l glucose alone, the integrated insulin response was 0.103 ± 0.056 μmol (n = 4) (28). Given the in vitro data, we hypothesized that [d-Ala2]GIP1–42 may have enhanced bioactivity in vivo relative to native GIP, resulting from its DP IV resistance.

In vivo bioassay of GIP and [d-Ala2]GIP in lean and obese rats.

Initial experiments were performed with conscious Wistar rats (287 ± 6.5 g; fasting glycemia, 4.7 ± 0.1 mmol/l; fasting insulin, 87.6 ± 11.6 pmol/l; fasting GIP, 606 ± 82 pg/ml; n ≥ 20). Subcutaneous injection of 8 nmol/kg GIP1–42 with a concurrent OGTT significantly reduced the glycemic profile relative to the saline control, and this was associated with increased circulating insulin levels (Fig. 6). Measurement of GIP levels by RIA indicated that this dose of GIP resulted in a 10-fold greater peak GIP level (control, 1.68 ± 0.17 ng/ml; treated, 16.6 ± 3.0 ng/ml) during the OGTT. The exogenous GIP appeared to be rapidly absorbed and to follow a similar elimination profile to that of endogenous GIP in control animals (data not shown). In contrast, the same dosage of GIP3–42 had no effect on postprandial glycemia or insulin release (Fig. 7). Subcutaneous injection of [d-Ala2]GIP1–42 resulted in a more pronounced reduction in the glycemic profile and an enhanced insulin time course than that of native GIP during an OGTT (Fig. 6). Notably, both GIP and d-Ala2-modified GIP appeared to exert their glucose-lowering effects by significant enhancement of the early phase of insulin release, whereas the latter peptide displayed more protracted bioactivity. Integrated glucose and insulin profiles can be found in Table 1.

Comparison of GIP and [d-Ala2]GIP was subsequently studied in the VDF Zucker animal model of type 2 diabetes (23). Age-matched obese animals (fa/fa; 576.1 ± 9.1 g) displayed significantly higher fasting glycemia than their lean (Fa/?; 335.6 ± 14.9 g) littermates (7.3 ± 0.3 mmol/l vs. 4.8 ± 0.1 mmol/l) and, similarly, a fasting hyperinsulinemia (979 ± 109 pmol/l vs. 8.5 ± 2.4 pmol/l), typical of this animal model (P < 0.05, n ≥ 20). Fasting GIP levels in these animals were not significantly different (lean, 954 ± 72 pg/ml; obese, 926 ± 110 pg/ml; n ≥ 13), whereas after an OGTT in control animals, postprandial GIP levels (the mean of samples taken at 10, 20, and 30 min) in obese rats (1,730 ± 170 pg/ml, n = 15) were significantly greater than levels in lean animals (1,150 ± 120 pg/ml, n = 19; P < 0.05). Injection of 8 nmol/kg GIP1–42 resulted in 15.4-fold (lean) and 9.6-fold (obese) greater peak GIP levels in vivo after the OGTT, relative to peak values in saline control animals. In lean animals, GIP injection produced moderate reductions in postprandial glycemic levels (16.8% reduction compared with saline control at 40 min using fold-basal values), whereas [d-Ala2]GIP1–42 was more potent (46.8% reduction at the same time point) (Fig. 8A). Similarly, in obese animals, comparison at the 40-min time point indicated that GIP reduced glycemia by 18.7% and [d-Ala2]GIP reduced glycemia by 41.5%, relative to the saline control (Fig. 9A). In lean VDF Zucker rats, both peptides appeared to similarly augment insulin release, with [d-Ala2]GIP resulting in more elevated insulin levels at the first time point (3.5 min) (Fig. 8B). However, in obese rats, differences in the potencies of GIP and DP IV-resistant GIP were more evident, with insulin levels remaining at near-peak values at the 60-min time point for the [d-Ala2]GIP-treated group, whereas insulin levels approached control values for the GIP-treated group after 1 h (Fig. 9B). Integrated glucose and insulin profiles for bioassay data can be found in Table 1.

Recognition of the importance of the structure of the NH2-terminus for biological activity of peptides in the secretin-glucagon superfamily has resulted in the development of numerous analogs with reduced in vivo catabolism and increased biological activity. Substitution of l-Tyr1 with the d-isomer in growth hormone-releasing hormone (GRH) (3133), l-His1 with d-His1 in glucagon (34) and GLP-1 (35), or d-amino acids in P2 of glucagon (27) or GLP-1 (36,37) results in peptides with increased in vivo potency. Although conformational changes in the molecules may play a role in increasing biological activity (34), a more prolonged biological half-life as a result of their resistance to enzymatic degradation is probably the more important factor. Frohman et al. (31,38) first showed the importance of DP IV in the physiological degradation of members of the secretin-glucagon superfamily, by demonstrating that GRH is metabolized to biologically inactive GRH3–44 by DP IV both in vitro and in vivo. Additionally, it was shown that amino-terminal substituted analogs, including des-amino-Tyr1-, d-Tyr1-, and d-Ala2-GRH, were resistant to DP IV cleavage (31). More recently, studies on GLP-1 have shown a similar resistance to DP IV degradation with analogs containing d-amino acids in the P2 NH2-terminal position (36,37). The current study was targeted at developing long-acting analogs of the second important incretin, GIP. During the preparation of this article, Flatt and colleagues (3942) reported on [Tyr1-Glucitol]GIP, a peptide analog modified postsynthesis, displaying both DP IV resistance and improvement of glucose tolerance in a diabetic mouse model.

Experiments were first carried out to establish the minimal structural requirements for the NH2-terminus of GIP for receptor binding and stimulation of adenylyl cyclase. Removal of the first two amino-terminal residues (GIP3–42), or inversion of these amino acids ([Ala1-Tyr2]GIP1–42), resulted in peptides that displayed reduced receptor affinity in competition binding studies and that were devoid of the ability to stimulate cAMP production in wtGIPR cells at concentrations as high as 10 μmol/l (Fig. 1). This supports the early claim that GIP3–42 isolated from porcine intestinal extracts lacked insulinotropic activity in the perfused rat pancreas (43). Both GIP3–42 and [Ala1-Tyr2]GIP1–42 were antagonists of GIP1–42-induced cAMP production in the micromolar range, inhibiting cAMP production by >90% (Fig. 2). Schmidt et al. (44) tested GIP3–42 for antagonism of GIP1–42 action on isolated rat islets and found that it was unable to reduce GIP-stimulated insulin release when administered in equal or 10-fold greater concentrations; Fig. 2 indicates that at least a 1,000-fold greater concentration of GIP3–42 is necessary to reduce native GIP action on the cloned receptor. The claim that GIP3–42 lacks insulinotropic activity is further supported by its lack of effect on glucose excursions and insulin profile when bioassayed in conscious Wistar rats (Fig. 7). In this bioassay, excess exogenous GIP3–42, injected subcutaneously, was unable to block or even change the insulinotropic effect of endogenously released GIP1–42 resulting from the oral glucose load; thus, it is extremely unlikely that GIP3–42 plays an antagonistic role in vivo.

Given the sensitivity of the NH2-terminus of GIP to inactivation by DP IV, we sought to generate peptide analogs resistant to this enzyme for use in vivo. Initial in vitro studies looked at modification or substitution of amino acids in positions 1–4 of GIP, using peptides based on the shorter 30-amino acid bioactive core of the hormone (1–30) (22). From this data, substitution with d-Ala in position 2 was shown to have the greatest potential for further development; preliminary trials found that this molecule was completely resistant to DP IV degradation for over 24 h and had minimal changes in receptor activity (22). When testing full-length [d-Ala2]GIP1–42 in the current report, these results were corroborated and studies continued in animal models. Although DP IV resistance did little to the effectiveness of the analog in vitro (consistent with the lack of DP IV activity in CHO cells; S.A.H., J.A. Pospisilik, R.A.P., C.H.S.M., unpublished data), when tested in vivo, [d-Ala2]GIP reduced glycemic excursions in all animal models to a greater extent than native GIP. This was associated with enhanced early-phase insulin release in lean animals (Figs. 6 and 8; Table 1); in diabetic rats, where the first phase of insulin release is compromised, an augmentation of the entire insulin time course was observed (Fig. 9). The latter finding is of particular interest, as GIP’s effectiveness in type 2 diabetes and animal models of the disease has been questioned and remains controversial. Lean Zucker rats showed significant differences in glycemic profiles between GIP and [d-Ala2]GIP, whereas both peptides appeared equally insulinotropic except at the first time point (2 min) (Fig. 8). Although the importance of the first phase of insulin release is well established, these data are also consistent with either an increased insulin sensitivity in these animals, as noted by Pederson et al. (18), and/or enhanced ability of this compound to stimulate glucose uptake in peripheral tissues (42).

Although GIP1–42 has been shown to exhibit insulinotropic activity equivalent to that of GLP-1 (45), there have been no previous reports targeted at developing long-acting analogs with therapeutic potential in type 2 diabetes until very recently, and these have been limited. The reason for the lack of such studies probably originates in the report of Nauck et al. (46), who observed that human GIP was almost devoid of insulinotropic activity in type 2 diabetic patients. It had been shown earlier that there was a reduced incretin response in type 2 diabetic patients, characterized by a reduction in the component of β-cell secretion resulting from oral glucose relative to that obtained with intravenous glucose (47). Additionally, the responsiveness of type 2 diabetic patients to exogenous porcine GIP, at concentrations resulting in physiological (48) or near-physiological (49) circulating levels, was blunted. It was also observed that porcine GIP1–42 stimulated insulin secretion under fasting conditions (50,51), whereas normal control subjects did not respond, presumably because circulating fasting glucose levels in type 2 diabetic patients reach the required threshold for the insulinotropic activity of GIP. Therefore, there appears to be little doubt that insulin responses to exogenous GIP are reduced in type 2 diabetic patients. Nevertheless, the pancreas still retains some GIP sensitivity. The reason for the almost complete lack of response to human GIP observed in the study of Nauck et al. (46) may lie elsewhere. In their study, responses of normal controls to the human peptide were also extremely weak, unlike those described by the same group in an earlier study with GIP from a different commercial source (52), suggesting that the synthetic human peptide used in the type 2 diabetes study exhibited only weak biological activity. It has recently been shown by us that some (45), but not all (26), commercial preparations of human GIP exhibit very low biological activity, and it is therefore critical that further clinical trials with human GIP and GIP analogs are performed with peptides of established biological activity.

It is also important to define the origin of the resistance to GIP. One possibility is increased receptor desensitization/downregulation or altered signal-transduction pathways (6,53,54). Alternative explanations include antagonism of GIP1–42 action by GIP3–42, as suggested for GLP-1 (21), or a genetic defect resulting in reduced receptor expression (55). Antagonism by GIP3–42 appears unlikely in view of its low binding affinity for the receptor and strength as an antagonist, with at least 1,000-fold higher concentrations being required to show a significant effect. However, some support for the latter hypothesis has come recently, with the finding that obese VDF Zucker rats have compromised GIP receptor expression, at both the mRNA and protein levels, in isolated islets of Langerhans (23). During an intraperitoneal glucose tolerance test, when GIP was infused at minimum threshold levels necessary to obtain a biological response in lean animals (4 pmol · min−1 · kg−1), obese animals were unable to respond to the same dose. This was linked to a defect in the ability to stimulate cAMP in isolated islets, and quantitative PCR and immunoblotting suggested a reduction in GIP receptor expression (23). The etiology of the diminished expression, however, has not been elucidated and may result from elevated postprandial GIP levels and subsequent desensitization/internalization/downregulation of the receptor. In the current study, fasting GIP levels in lean and obese VDF Zucker rats were not significantly different, confirming the result of Lynn et al. (23); however, elevated levels of GIP were detected in obese animals after an OGTT, lending support for the downregulation hypothesis.

The significance of GIP as a physiological incretin has been emphasized in studies using specific GIP antagonists in rat (56) and inhibition of DP IV activity in GLP-1 receptor knockout mice (57). With the important findings that sulfonylureas improve β-cell sensitivity to GIP (58), that smaller fragments of GIP are bioactive (28,29), and in the present report, that even in animals with compromised GIP receptor expression, supraphysiological concentrations of GIP and analogs with improved plasma stability are still capable of improving glucose tolerance, the pharmacological potential of GIP in treatment of human diabetic states is preserved. To truly recognize the potential of GIP and degradation-resistant analogs, the extent of the reduced sensitivity to GIP in diabetic patients needs to be quantitatively assessed using a wide range of peptide concentrations, as has been done for GLP-1 (59), rather than single low-dosage protocols, biased to show a lack of effectiveness. No matter what underlying cause is ultimately determined to be responsible for the reduced responsiveness to GIP in human type 2 diabetes, analogs based on the DP IV-resistant form described here may be useful in stimulating insulin secretion through the residual islet capacity to respond to this incretin.

The study was funded by grants from the Medical Research Council of Canada/Canadian Institute of Health Research (590007; R.A.P./C.H.S.M.), Canadian Diabetes Association (C.H.S.M./R.A.P.), and the Department of Science and Technology of Sachsen Anhalt (grant no. 9704/00116; H.-U.D.). S.A.H. is funded by the Medical Research Council of Canada/Canadian Institute of Health Research and the Killam Trusts.

1.
Pederson RA: Gastric inhibitory polypeptide. In
Gut Peptides: Biochemistry and Physiology.
Walsh JH, Dockray GJ, Eds. Raven Press, New York,
1994
, p.
217
–259
2.
Gromada J, Bokvist K, Ding W-G, Holst JJ, Nielsen JH, Rorsman P: Glucagon-like peptide 1(7–36) amide stimulates exocytosis in human pancreatic β-cells by both proximal and distal regulatory steps in stimulus-secretion coupling.
Diabetes
47
:
57
–65,
1998
3.
Ding W-G, Gromada J: Protein kinase A-dependent stimulation of exocytosis in mouse pancreatic β-cells by glucose-dependent insulinotropic polypeptide.
Diabetes
46
:
615
–621,
1997
4.
Béguin P, Nagashima K, Nishimura M, Gonoi T, Seino S: PKA-mediated phosphorylation of the human K(ATP) channel: separate roles of Kir6.2 and SUR1 subunit phosphorylation.
EMBO J
18
:
4722
–4732,
1999
5.
McIntosh CHS, Wheeler MB, Gelling RW, Brown JC, Pederson RA: GIP receptors and signal-transduction mechanisms.
Acta Physiol Scand
157
:
361
–365,
1996
6.
Ehses JA, Lee SS, Pederson RA, McIntosh CHS: A new pathway for glucose-dependent insulinotropic polypeptide (GIP) receptor signalling: evidence for the involvement of phospholipase A2 in GIP-stimulated insulin secretion.
J Biol Chem
276
:
23667
–23673,
2001
7.
Fehmann H-C, Burkhard G: Characterization of GIP(1–30) and GIP(1–42) as stimulators of proinsulin gene transcription.
Peptides
16
:
1149
–1152,
1995
8.
Wang Y, Montrose-Rafizadeh M, Adams L, Raygada M, Nadiv O, Egan JM: GIP regulates glucose transporters, hexokinases, and glucose induced insulin secretion in RIN 1046–38 cells.
Mol Cell Endocrinol
116
:
81
–87,
1996
9.
Holst JJ: Glucagon-like peptide-1, a gastrointestinal hormone with pharmaceutical potential.
Curr Med Chem
6
:
1005
–1017,
1999
10.
Demuth H-U, Heins J: Catalytic mechanism of dipeptidyl peptidase. IV. In
Dipeptidyl Peptidase IV (CD26) in Metabolism and the Immune Response.
Fleischer B, Ed. R.G. Landes, Georgetown, TX,
1995
, p.
1
–35
11.
Mentlein R: Dipeptidyl-peptidase IV (CD26): role in the inactivation of regulatory peptides.
Regul Pept
85
:
9
–25,
1999
12.
Kieffer TJ, McIntosh CHS, Pederson RA: Degradation of glucose-dependent insulinotropic polypeptide and truncated glucagon-like peptide 1 in vitro and in vivo by dipeptidyl peptidase IV.
Endocrinology
136
:
3585
–3596,
1995
13.
Knudsen LB, Pridal L: Glucagon-like peptide-1-(9–36) amide is a major metabolite of glucagon-like peptide-1-(7–36) amide after in vivo administration to dogs, and it acts as an antagonist on the pancreatic receptor.
Eur J Pharmacol
318
:
429
–435,
1996
14.
Mentlein R, Gallwitz B, Schmidt WE: Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1 (7–36)amide, peptide histidine methionine and is responsible for their degradation in human serum.
Eur J Biochem
214
:
829
–835,
1993
15.
Pauly RP, Rosche F, Wermann M, McIntosh CHS, Pederson RA, Demuth H-U: Investigation of GIP1–42 and GLP-1 7–36 degradation in vitro by dipeptidyl peptidase IV (DPIV) using matrix-assisted laser desorption/ionization-time of flight mass spectometry (MALDI-TOF MS): a novel kinetic approach.
J Biol Chem
271
:
23222
–23229,
1996
16.
Miyawaki K, Yamada Y, Yano H, Niwa H, Ban N, Ihara Y, Kubota A, Fujimoto S, Kajikawa M, Kuroe A, Tsuda K, Hashimoto H, Yamashita T, Jomori T, Tashiro F, Miyazaki J, Seino Y: Glucose intolerance caused by a defect in the enteroinsular axis: a study in gastric inhibitory polypeptide receptor knockout mice.
Proc Natl Acad Sci U S A
96
:
1483
–1487,
1999
17.
Pauly RP, Demuth H-U, Rosche F, Schmidt J, White HA, Lynn F, McIntosh CHS, Pederson RA: Improved glucose tolerance in rats treated with the dipeptidyl peptidase IV (CD26) inhibitor ile-thiazolidide.
Metabolism
48
:
385
–389,
1999
18.
Pederson RA, White HA, Schlenzig D, Pauly RP, McIntosh CHS, Demuth H-U: Improved glucose tolerance in Zucker fatty rats by oral administration of the dipeptidyl peptidase IV inhibitor isoleucine thiazolidide.
Diabetes
47
:
1253
–1258,
1998
19.
Deacon CF, Hughes TE, Holst JJ: Dipeptidyl peptidase IV inhibition potentiates the insulinotropic effect of glucagon-like peptides 1 in the anesthetized pig.
Diabetes
47
:
764
–769,
1998
20.
Balkan B, Kwasnik L, Miserendino R, Holst JJ, Li X: Inhibition of dipeptidyl peptidase IV with NVP-DPP728 increases plasma GLP-1 (7–36 amide) concentrations and improves oral glucose tolerance in obese Zucker rats.
Diabetologia
42
:
1324
–1331,
1999
21.
Deacon CF, Nauck MA, Toft-Nielsen M, Pridal L, Willms B, Holst JJ: Both subcutaneously and intravenously administered glucagon-like peptide I are rapidly degraded from the NH2-terminus in type II diabetic patients and in healthy subjects.
Diabetes
44
:
1126
–1131,
1995
22.
Kühn-Wache K, Manhart S, Hoffmann T, Hinke SA, Gelling R, Pederson RA, McIntosh CHS, Demuth H-U: Synthesis of analogs of glucose-dependent insulinotropic polypeptide with increased dipeptidyl peptidase IV resistance.
Adv Exp Med Biol
477
:
187
–195,
2000
23.
Lynn FC, Pamir N, Ng EHC, McIntosh CHS, Kieffer TJ, Pederson RA: Defective glucose-dependent insulinotropic polypeptide receptor expression in diabetic fatty Zucker rats.
Diabetes
50
:
1004
–1011,
2001
24.
Wolf B, Fischer G, Barth A: Kinetische Untersuchungen an der Dipeptidyl-Peptidase IV [Kinetics of dipeptidyl-peptidase IV].
Acta Biol Med Ger
37
:
409
–420,
1978
25.
Gelling RW, Coy DH, Pederson RA, Wheeler MB, Hinke S, Kwan T, McIntosh CHS: GIP6–30amide contains the high affinity binding region of GIP and is a potent inhibitor of GIP1–42 action in vitro.
Regul Pept
69
:
151
–154,
1997
26.
Wheeler MB, Gelling RW, McIntosh CHS, Georgiou J, Brown JC, Pederson RA: Functional expression of the rat pancreatic islet glucose-dependent insulinotropic polypeptide receptor: ligand binding and intracellular signaling properties.
Endocrinology
136
:
4629
–4639,
1995
27.
Hinke SA, Pospisilik JA, Demuth H-U, Manhart S, Kühn-Wache K, Hoffmann T, Nishimura E, Pederson RA, McIntosh CHS: Dipeptidyl peptidase IV degradation of glucagon: characterization of glucagon degradation products and DPIV resistant analogs.
J Biol Chem
275
:
3827
–3834,
2000
28.
Hinke SA, Manhart S, Pamir N, Demuth H-U, Gelling RW, Pederson RA, McIntosh CHS: Identification of a bioactive domain in the amino-terminus of glucose-dependent insulinotropic polypeptide.
Biochim Biophys Acta
1547
:
143
–155,
2001
29.
Morrow GW, Kieffer TJ, McIntosh CHS, MacGillvray RTA, Brown JC, St-Pierre S, Pederson RA: The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30.
Can J Physiol Pharmacol
74
:
65
–72,
1996
30.
Pederson RA, Satkunarajah M, McIntosh CHS, Scrocchi LA, Flamez D, Schuit F, Drucker DJ, Wheeler MB: Enhanced glucose-dependent insulinotropic polypeptide secretion and insulinotropic action in glucagon-like peptide 1 receptor -/- mice.
Diabetes
47
:
1046
–1052,
1998
31.
Frohman LA, Downs TR, Heimer EP, Felix AM: Dipeptidyl peptidase IV and trypsin-like enzymatic degradation of human growth hormone-releasing hormone in plasma.
J Clin Invest
83
:
1533
–1540,
1989
32.
Heiman ML, Nekola MV, Murphy WA, Lance VA, Coy DH: An extremely sensitive in vitro model for elucidating structure-activity relationships of growth hormone-releasing factor analogs.
Endocrinology
116
:
410
–415,
1985
33.
Lance VA, Murphy WA, Sueiras-Diaz J, Coy DH: Super-active analogs of growth hormone-releasing factor (1–29)-amide.
Biochem Biophys Res Commun
119
:
265
–272,
1984
34.
Sueiras-Diaz J, Lance VA, Murphy WA, Coy DH: Structure-activity studies on the N-terminal region of glucagon.
J Med Chem
27
:
310
–315,
1984
35.
Deacon CF, Knudsen LB, Madsen K, Wiberg FC, Jacobsen O, Holst JJ: Dipeptidyl peptidase IV resistant analogues of glucagon-like peptide-1 which have extended metabolic stability and improved biological activity.
Diabetologia
41
:
271
–278,
1998
36.
Xiao Q, Giguere J, Parisien M, Jeng W, St-Pierre SA, Brubaker PL, Wheeler MB: Biological activities of glucagon-like peptide-1 analogues in vitro and in vivo.
Biochemistry
40
:
2860
–2869,
2001
37.
Siegel EG, Gallwitz B, Scharf G, Mentlein R, Morys-Wortmann C, Fölsch UR, Schrezenmeir J, Drescher K, Schmidt WE: Biological activity of GLP-1 analogues with N-terminal modifications.
Regul Pept
79
:
93
–102,
1999
38.
Frohman LA, Downs TR, Williams TC, Heimer EP, Pan YC, Felix AM: Rapid enzymatic degradation of growth hormone-releasing hormone by plasma in vitro and in vivo to a biologically inactive product cleaved at the NH2 terminus.
J Clin Invest
78
:
906
–913,
1986
39.
O’Harte FPM, Mooney MH, Kelly CMN, Flatt PR: Improved glycaemic control in obese diabetic ob/ob mice using N-terminally modified gastric inhibitory polypeptide.
J Endocrinol
165
:
639
–648,
2000
40.
O’Harte FPM, Mooney MH, Flatt PR: NH2-terminally modified gastric inhibitory polypeptide exhibits amino-peptidase resistance and enhanced antihyperglycemic activity.
Diabetes
48
:
758
–765,
1999
41.
O’Harte FPM, Abdel-Wahab YHA, Conlon JM, Flatt PR: Amino terminal glycation of gastric inhibitory polypeptide enhances its insulinotropic action on clonal pancreatic B-cells.
Biochim Biophys Acta
1425
:
319
–327,
1998
42.
O’Harte FPM, Gray AM, Flatt PR: Gastric inhibitory polypeptide and effects of glycation on glucose transport and metabolism in isolated mouse abdominal muscle.
J Endocrinol
156
:
237
–243,
1998
43.
Brown JC, Dahl M, Kwauk S, McIntosh CHS, Otte SC, Pederson RA: Actions of GIP.
Peptides Suppl
2
:
241
–245,
1981
44.
Schmidt WE, Siegel EG, Kümmel H, Gallwitz B, Creutzfeldt W: Commercially available preparations of porcine glucose-dependent insulinotropic polypeptide (GIP) contain a biologically inactive GIP-fragment and cholecystokinin-33/39.
Endocrinology
120
:
835
–837,
1987
45.
Jia X, Brown JC, Ma P, Pederson RA, McIntosh CHS: Effects of glucose-dependent insulinotropic polypeptide and glucagon-like peptide-I-(7–36) on insulin secretion.
Am J Physiol
268
:
E645
–E651,
1995
46.
Nauck MA, Heimesaat MM, Ørskov C, Holst JJ, Ebert R, Creutzfeldt W: Preserved incretin activity of glucagon-like peptide-1 (7–36amide), but not of synthetic human gastric inhibitory polypeptide in patients with type-2 diabetes mellitus.
J Clin Invest
91
:
301
–307,
1993
47.
Nauck MA, Kleine N, Ørskov C, Holst JJ, Willms B, Creutzfeldt W: Normalization of fasting hyperglycaemia by exogenous glucagon-like peptide 1 (7–36 amide) in type 2 (non-insulin-dependent) diabetic patients.
Diabetologia
36
:
741
–744,
1993
48.
Jones IR, Owens DR, Moody AJ, Luzio SD, Morris T, Hayes TM: The effects of glucose-dependent insulinotropic polypeptide infused at physiological concentrations in normal subjects and type 2 (non-insulin-dependent) diabetic patients on glucose tolerance and B-cell secretion.
Diabetologia
30
:
707
–712,
1987
49.
Krarup T, Saurbrey N, Moody AJ, Kuhl C, Madsbad S: Effect of porcine gastric inhibitory polypeptide on beta-cell function in type-I and type-II diabetes mellitus.
Metabolism
36
:
677
–682,
1987
50.
Amland PF, Jorde R, Aanderud S, Burhol PG, Giercksky K-E: Effects of intravenously infused porcine GIP on serum insulin, plasma C-peptide, and pancreatic polypeptide in non-insulin-dependent diabetes.
Scand J Gastroenterol
20
:
315
–320,
1985
51.
Jones IR, Owens DR, Luzio S, Hayes TM: Glucose dependent insulinotropic polypeptide (GIP) infused intravenously is insulinotropic in the fasting state in type 2 (non-insulin dependent) diabetes mellitus.
Horm Metabol Res
21
:
23
–26,
1989
52.
Nauck M, Schmidt WE, Ebert R, Strietzel J, Cantor P, Hoffmann G, Creutzfeldt W: Insulinotropic properties of synthetic human gastric inhibitory polypeptide in man: interactions with glucose, phenylalanine, and cholecystokinin-8.
J Clin Endocrinol Metab
69
:
654
–662,
1989
53.
Hinke SA, Pauly RP, Ehses J, Kerridge P, Demuth H-U, McIntosh CHS, Pederson RA: Role of glucose in chronic desensitization of isolated rat islets and mouse insulinoma (βTC-3) cells to glucose-dependent insulinotropic polypeptide.
J Endocrinol
165
:
281
–291,
2000
54.
Wheeler MB, Gelling RW, Hinke SA, Tu B, Chandy MJ, Lynn FC, Ehses J, Pederson RA, McIntosh CHS: Characterization of the carboxyl-terminal domain of the rat glucose-dependent insulinotropic polypeptide (GIP) receptor: a role for serines 426 and 427 in internalization.
J Biol Chem
274
:
24593
–24601,
1999
55.
Holst JJ, Gromada J, Nauck MA: The pathogenesis of non-insulin dependent diabetes mellitus involves a defective expression of the GIP receptor.
Diabetologia
40
:
984
–986,
1997
56.
Tseng C-C, Jarboe LA, Landau SB, Williams EK, Wolfe MM: Postprandial stimulation of insulin release by glucose-dependent insulinotropic polypeptide (GIP): effect of a specific glucose-dependent insulinotropic polypeptide antagonist in the rat.
J Clin Invest
98
:
2440
–2445,
1996
57.
Marguet D, Baggio L, Kobayashi T, Bernard A-M, Pierres M, Nielsen PF, Ribel U, Watanabe T, Drucker DJ, Wagtmann N: Enhanced insulin secretion and improved glucose tolerance in mice lacking CD26.
Proc Natl Acad Sci U S A
97
:
6874
–6879,
2000
58.
Meneilly GS, Bryer-Ash M, Elahi D: The effect of glyburide on beta-cell sensitivity to glucose-dependent insulinotropic polypeptide.
Diabetes Care
16
:
110
–114,
1993
59.
Ritzel R, Ørskov C, Holst JJ, Nauck MA: Pharmacokinetic, insulinotropic, and glucagonostatic properties of GLP-1 [7–36 amide] after subcutaneous injection in healthy volunteers: dose-response relationships.
Diabetologia
38
:
720
–725,
1995

Address correspondence and reprint requests to Christopher McIntosh, Department of Physiology, Faculty of Medicine, University of British Columbia, 2146 Health Sciences Mall, Vancouver, British Columbia, Canada V6T 1Z3. E-mail: mcintoch@interchange.ubc.ca.

Received for publication 12 September 2001 and accepted in revised form 19 November 2001.

DP IV, dipeptidyl peptidase IV; EC50, half-maximal stimulatory concentration; GIP, glucose-dependent insulinotropic polypeptide; GLP-1, glucagon-like peptide-1; GRH, growth hormone-releasing hormone; HBS, HEPES-buffered saline; HPLC, high-performance liquid chromatography; IC50, half-maximal inhibitory concentration; OGTT, oral glucose tolerance test; RIA, radioimmunoassay; RT, retention time; TFA, trifluoroacetic acid.